PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g16280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 615aa    MW: 67402.5 Da    PI: 7.0583
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g16280genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3764.2e-24161262199
                EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                f+k+lt sd++++g +++p++ ae++      ++++ s++l  +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + ++++l+++
  Tp4g16280 161 FCKTLTASDTSTHGGFSVPRRAAEDCfppldYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDDGKLRLG 258
                99****************************955566778*************************************************..3489999*** PP

                EE-S CS
         B3  96 vfrk 99 
                v+r+
  Tp4g16280 259 VRRA 262
                9986 PP

2Auxin_resp109.92.7e-36287368182
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 +aha+st+s+F+++YnP+as+s+F+++  k++k ++ ++++GmRfk ++e+ed+serr  G+++g+sdldp+rWp+SkWr+L
   Tp4g16280 287 VAHAISTNSAFNIYYNPKASWSNFIIPGPKFLKIVDYPFCIGMRFKARVESEDASERRSPGIITGISDLDPIRWPGSKWRCL 368
                 79*******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.35E-42151277IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.3E-39155270IPR015300DNA-binding pseudobarrel domain
CDDcd100171.07E-21159261No hitNo description
PfamPF023624.6E-22161262IPR003340B3 DNA binding domain
PROSITE profilePS5086313.197161263IPR003340B3 DNA binding domain
SMARTSM010199.0E-22161263IPR003340B3 DNA binding domain
PfamPF065074.2E-30287368IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MGGLIDLNVM ETEEDETPSS ASGSLSPSSS SSASASAFAV SGSSSSSSSP GVCLELWHAC  60
AGPLISLPKR GSLVLYFPQG HLEQQAPDFS AAIYGLRPHV FCRILDVKLH AETATDEVYA  120
QVSLLPESED IERKVREGII DVDGGEEDYE VLKRSNTPHM FCKTLTASDT STHGGFSVPR  180
RAAEDCFPPL DYSQPRPSQE LLARDLHGLE WRFRHIYRGQ PRRHLLTTGW SAFVNKKKLV  240
SGDAVLFLRG DDGKLRLGVR RAAQIEGASA FSTQYNQNMN QNNFAEVAHA ISTNSAFNIY  300
YNPKASWSNF IIPGPKFLKI VDYPFCIGMR FKARVESEDA SERRSPGIIT GISDLDPIRW  360
PGSKWRCLLV RWDDIEANGR QQRVSPWEIE PSGSISNSGS FITTGPKRSR IGFSSGKPDI  420
PVSEGIHATD FEESLRFQRV LQGQEIFPGF INTSSDGGAG ARRGRFKGTD FGDSYGFHKV  480
LQGQETVSAF PMTDHRQQGM SQRNIWCGPF QNFSTRILPP SSVHVSSSPS SVLITNSSGP  540
KGRLEDHHGG SGRCRLFGFP LTDETTAVAS AMVVPCVEGQ NGNHMKGASA VQSNHHHSQG  600
RDIYGMRDML LDIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-110403981361Auxin response factor 1
4ldw_A1e-110403981361Auxin response factor 1
4ldv_A1e-110403981361Auxin response factor 1
4ldy_B1e-110403981361Auxin response factor 1
4ldy_A1e-110403981361Auxin response factor 1
4ldx_B1e-110403981361Auxin response factor 1
4ldx_A1e-110403981361Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3369170.0AF336917.1 Arabidopsis thaliana auxin response transcription factor 3 (At2g33860) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410539.10.0hypothetical protein EUTSA_v10016394mg
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLV4MA800.0V4MA80_EUTSA; Auxin response factor
STRINGAT2G33860.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49242849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein